Recombinant Hevea brasiliensis Pro-hevein (HEV1), Unconjugated, E. coli

Catalog Number: BIM-RPC22815
Article Name: Recombinant Hevea brasiliensis Pro-hevein (HEV1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22815
Supplier Catalog Number: RPC22815
Alternative Catalog Number: BIM-RPC22815-20UG,BIM-RPC22815-100UG,BIM-RPC22815-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Major hevein
Recombinant Hevea brasiliensis Pro-hevein (HEV1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis). Target Name: HEV1. Target Synonyms: Major hevein. Accession Number: P02877. Expression Region: 18~204aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN
Target: HEV1