Recombinant Influenza B virus Non-structural protein 1 (NS), Unconjugated, E. coli

Catalog Number: BIM-RPC22823
Article Name: Recombinant Influenza B virus Non-structural protein 1 (NS), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22823
Supplier Catalog Number: RPC22823
Alternative Catalog Number: BIM-RPC22823-20UG,BIM-RPC22823-100UG,BIM-RPC22823-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: NS1A
Recombinant Influenza B virus Non-structural protein 1 (NS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza B virus (strain B/Lee/1940). Target Name: NS. Target Synonyms: NS1A. Accession Number: P03502. Expression Region: 1~281aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MADNMTTTQIEVGPGATNATINFEAGILECYERFSWQRALDYPGQDRLHRLKRKLESRIKTHNKSEPENKRMSLEERKAIGVKMMKVLLFMDPSAGIEGFEPYCVKNPSTSKCPNYDWTDYPPTPGKYLDDIEEEPENVDHPIEVVLRDMNNKDARQKIKDEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGDKSLSTLHRLNAYDQNGGLVAKLVATDDRTVEDEKDGHRILNSLFERFDEGHSKPI
Target: NS