Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5), Unconjugated, E. coli

Catalog Number: BIM-RPC22825
Article Name: Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22825
Supplier Catalog Number: RPC22825
Alternative Catalog Number: BIM-RPC22825-20UG,BIM-RPC22825-100UG,BIM-RPC22825-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Single-stranded DNA-binding protein, SSB protein
Recombinant Enterobacteria phage T7 Single-stranded DNA-binding protein gp2.5 (2.5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Enterobacteria phage T3 (Bacteriophage T3). Target Name: 2.5. Target Synonyms: Single-stranded DNA-binding protein, SSB protein. Accession Number: P03696. Expression Region: 1~232aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 41.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 41.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
Target: 2.5