Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit (polC), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22828
Article Name: Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit (polC), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22828
Supplier Catalog Number: RPC22828
Alternative Catalog Number: BIM-RPC22828-20UG,BIM-RPC22828-100UG,BIM-RPC22828-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: polC, CENSYa_1827DNA polymerase II large subunit, Pol II, EC 2.7.7.7, Exodeoxyribonuclease large subunit, EC 3.1.11.1
Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit (polC), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Cenarchaeum symbiosum (strain A). Target Name: polC. Target Synonyms: polC, CENSYa_1827DNA polymerase II large subunit, Pol II, EC 2.7.7.7, Exodeoxyribonuclease large subunit, EC 3.1.11.1. Accession Number: A0RYM0. Expression Region: 287~832aa. Tag Info: Tag-Free. Theoretical MW: 59kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 59kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDN
Target: polC