Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6, Unconjugated, E. coli

Catalog Number: BIM-RPC22847
Article Name: Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22847
Supplier Catalog Number: RPC22847
Alternative Catalog Number: BIM-RPC22847-20UG,BIM-RPC22847-100UG,BIM-RPC22847-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Three-finger toxin 3FTx-Oxy6
Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Oxyuranus microlepidotus (Inland taipan). Target Name: Oxyuranus microlepidotus Toxin 3FTx-Oxy6. Target Synonyms: Three-finger toxin 3FTx-Oxy6. Accession Number: A7X4T2. Expression Region: 22~81aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 26.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.9kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK
Target: Oxyuranus microlepidotus Toxin 3FTx-Oxy6