Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3), Unconjugated, E. coli

Catalog Number: BIM-RPC22916
Article Name: Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22916
Supplier Catalog Number: RPC22916
Alternative Catalog Number: BIM-RPC22916-20UG,BIM-RPC22916-100UG,BIM-RPC22916-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: ORF3, Protein ORF3, pORF3
Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1). Target Name: ORF3. Target Synonyms: ORF3, Protein ORF3, pORF3. Accession Number: O90299. Expression Region: 1~114aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.8kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR
Target: ORF3