Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5), Unconjugated, E. coli

Catalog Number: BIM-RPC22918
Article Name: Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22918
Supplier Catalog Number: RPC22918
Alternative Catalog Number: BIM-RPC22918-20UG,BIM-RPC22918-100UG,BIM-RPC22918-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Arachnid
Conjugation: Unconjugated
Alternative Names: Allergen: Blo t 5
Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Blomia tropicalis (Mite). Target Name: BLOT5. Target Synonyms: Allergen: Blo t 5. Accession Number: O96870. Expression Region: 1~134aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 31.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 31.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ
Target: BLOT5