Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22929
Article Name: Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22929
Supplier Catalog Number: RPC22929
Alternative Catalog Number: BIM-RPC22929-20UG,BIM-RPC22929-100UG,BIM-RPC22929-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: 132 kDa crystal proteinCrystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b)cryIF(b), cryINA67-1
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus thuringiensis subsp. Morrisoni. Target Name: cry1Fb. Target Synonyms: 132 kDa crystal proteinCrystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b)cryIF(b), cryINA67-1. Accession Number: O66377. Expression Region: 984~1169aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Target: cry1Fb