Recombinant Influenza A virus Nucleoprotein (NP), Unconjugated, E. coli

Catalog Number: BIM-RPC22930
Article Name: Recombinant Influenza A virus Nucleoprotein (NP), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22930
Supplier Catalog Number: RPC22930
Alternative Catalog Number: BIM-RPC22930-20UG,BIM-RPC22930-100UG,BIM-RPC22930-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Nucleocapsid protein, Protein N
Recombinant Influenza A virus Nucleoprotein (NP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/Kitakyushu/159/1993 H3N2). Target Name: NP. Target Synonyms: Nucleocapsid protein, Protein N. Accession Number: O91743. Expression Region: 1~498aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 60.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 60.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNRYLEEHPSAGKDPKKTGGPIYKRVDGRWMRELVLYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDTTYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRGINDRNFWRGENGRKTRSAYERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIED
Target: NP