Recombinant Human CMP-N-acetylneuraminate-beta-1, 4-galactoside alpha-2, 3-sialyltransferase (ST3GAL3), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22954
Article Name: Recombinant Human CMP-N-acetylneuraminate-beta-1, 4-galactoside alpha-2, 3-sialyltransferase (ST3GAL3), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22954
Supplier Catalog Number: RPC22954
Alternative Catalog Number: BIM-RPC22954-20UG,BIM-RPC22954-100UG,BIM-RPC22954-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Beta-galactoside alpha-2,3-sialyltransferase 3, Alpha 2,3-ST 3Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferaseN-acetyllactosaminide alpha-2,3-sialyltransferase, ST3Gal III, ST3GalIIIST3NSialyltransferase 6
Recombinant Human CMP-N-acetylneuraminate-beta-1, 4-galactoside alpha-2, 3-sialyltransferase (ST3GAL3), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ST3GAL3. Target Synonyms: Beta-galactoside alpha-2,3-sialyltransferase 3, Alpha 2,3-ST 3Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferaseN-acetyllactosaminide alpha-2,3-sialyltransferase, ST3Gal III, ST3GalIIIST3NSialyltransferase 6. Accession Number: Q11203. Expression Region: 29~375aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 54.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 54.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFT
Target: ST3GAL3