Recombinant Oryza sativa subsp. japonica Mitogen-activated protein kinase 5 (MPK5), Unconjugated, E. coli

Catalog Number: BIM-RPC22956
Article Name: Recombinant Oryza sativa subsp. japonica Mitogen-activated protein kinase 5 (MPK5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22956
Supplier Catalog Number: RPC22956
Alternative Catalog Number: BIM-RPC22956-20UG,BIM-RPC22956-100UG,BIM-RPC22956-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Benzothiadiazole-induced MAP kinase 1MAP kinase 2Multiple stress-responsive MAP kinase 2OsBIMK1OsMAP1OsMAPK2OsMAPK5OsMPK3OsMSRMK2BIMK1, MAPK2, MAPK5, MPK3, MSRMK2
Recombinant Oryza sativa subsp. japonica Mitogen-activated protein kinase 5 (MPK5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Oryza sativa subsp. japonica (Rice). Target Name: MPK5. Target Synonyms: Benzothiadiazole-induced MAP kinase 1MAP kinase 2Multiple stress-responsive MAP kinase 2OsBIMK1OsMAP1OsMAPK2OsMAPK5OsMPK3OsMSRMK2BIMK1, MAPK2, MAPK5, MPK3, MSRMK2. Accession Number: Q10N20. Expression Region: 1~369aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MDGAPVAEFRPTMTHGGRYLLYDIFGNKFEVTNKYQPPIMPIGRGAYGIVCSVMNFETREMVAIKKIANAFNNDMDAKRTLREIKLLRHLDHENIIGIRDVIPPPIPQAFNDVYIATELMDTDLHHIIRSNQELSEEHCQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPSSESDMMTEYVVTRWYRAPELLLNSTDYSAAIDVWSVGCIFMELINRQPLFPGRDHMHQMRLITEVIGT
Target: MPK5