Recombinant Human Serine/threonine-protein kinase PAK 1 (PAK1), Unconjugated, E. coli

Catalog Number: BIM-RPC22963
Article Name: Recombinant Human Serine/threonine-protein kinase PAK 1 (PAK1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22963
Supplier Catalog Number: RPC22963
Alternative Catalog Number: BIM-RPC22963-20UG,BIM-RPC22963-100UG,BIM-RPC22963-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Alpha-PAKp21-activated kinase 1, PAK-1p65-PAK
Recombinant Human Serine/threonine-protein kinase PAK 1 (PAK1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PAK1. Target Synonyms: Alpha-PAKp21-activated kinase 1, PAK-1p65-PAK. Accession Number: Q13153. Expression Region: 1~545aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 76.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 76.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILE
Target: PAK1