Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1), Unconjugated, E. coli

Catalog Number: BIM-RPC22975
Article Name: Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22975
Supplier Catalog Number: RPC22975
Alternative Catalog Number: BIM-RPC22975-20UG,BIM-RPC22975-100UG,BIM-RPC22975-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cysteine-S-conjugate beta-lyase (EC:4.4.1.13)Glutamine transaminase K, GTKGlutamine--phenylpyruvate transaminase (EC:2.6.1.64)Kynurenine aminotransferase I, KATIKynurenine--oxoglutarate transaminase I
Recombinant Human Kynurenine--oxoglutarate transaminase 1 (KYAT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: KYAT1. Target Synonyms: Cysteine-S-conjugate beta-lyase (EC:4.4.1.13)Glutamine transaminase K, GTKGlutamine--phenylpyruvate transaminase (EC:2.6.1.64)Kynurenine aminotransferase I, KATIKynurenine--oxoglutarate transaminase I. Accession Number: Q16773. Expression Region: 1~372aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 58.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 58.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSY
Target: KYAT1