Recombinant Human NADP-dependent malic enzyme, mitochondrial (ME3), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22976
Article Name: Recombinant Human NADP-dependent malic enzyme, mitochondrial (ME3), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22976
Supplier Catalog Number: RPC22976
Alternative Catalog Number: BIM-RPC22976-20UG,BIM-RPC22976-100UG,BIM-RPC22976-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Malic enzyme 3
Recombinant Human NADP-dependent malic enzyme, mitochondrial (ME3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ME3. Target Synonyms: Malic enzyme 3. Accession Number: Q16798. Expression Region: 24~590aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 67.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 67.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: RWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQ
Target: ME3