Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22996
Article Name: Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22996
Supplier Catalog Number: RPC22996
Alternative Catalog Number: BIM-RPC22996-20UG,BIM-RPC22996-100UG,BIM-RPC22996-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: TEA domain family member 4, TEAD-4Transcription factor 13-like 1Transcription factor RTEF-1
Recombinant Human Transcriptional enhancer factor TEF-3 (TEAD4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TEAD4. Target Synonyms: TEA domain family member 4, TEAD-4Transcription factor 13-like 1Transcription factor RTEF-1. Accession Number: Q15561. Expression Region: 74~434aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.7kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMII
Target: TEAD4