Recombinant Human Mothers against decapentaplegic homolog 2 (SMAD2), Unconjugated, E. coli

Catalog Number: BIM-RPC22997
Article Name: Recombinant Human Mothers against decapentaplegic homolog 2 (SMAD2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22997
Supplier Catalog Number: RPC22997
Alternative Catalog Number: BIM-RPC22997-20UG,BIM-RPC22997-100UG,BIM-RPC22997-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: JV18-1Mad-related protein 2
Recombinant Human Mothers against decapentaplegic homolog 2 (SMAD2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SMAD2. Target Synonyms: JV18-1Mad-related protein 2. Accession Number: Q15796. Expression Region: 2~467aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 68.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 68.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSP
Target: SMAD2