Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2), Unconjugated, E. coli

Catalog Number: BIM-RPC23001
Article Name: Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23001
Supplier Catalog Number: RPC23001
Alternative Catalog Number: BIM-RPC23001-20UG,BIM-RPC23001-100UG,BIM-RPC23001-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Multisynthase complex auxiliary component p38Protein JTV-1
Recombinant Human Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 (AIMP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: AIMP2. Target Synonyms: Multisynthase complex auxiliary component p38Protein JTV-1. Accession Number: Q13155. Expression Region: 1~320aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 39.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAV
Target: AIMP2