Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV), Unconjugated, E. coli

Catalog Number: BIM-RPC23076
Article Name: Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23076
Supplier Catalog Number: RPC23076
Alternative Catalog Number: BIM-RPC23076-20UG,BIM-RPC23076-100UG,BIM-RPC23076-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: rplV, APH_0285, 50S ribosomal protein L22
Recombinant Anaplasma phagocytophilum 50S ribosomal protein L22 (rplV) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Anaplasma phagocytophilum (strain HZ). Target Name: rplV. Target Synonyms: rplV, APH_0285, 50S ribosomal protein L22. Accession Number: Q2GL54. Expression Region: 1~112aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSIVIAAKGLGLRSTPAKLNLVADLIRGKDVAVAAMYLKFCKKKAALLIDKVLKSAIANARANYGVDADNLYVKEVLVGKAFTLRRVQPRARGRACRISKRYGSVVVKLLER
Target: rplV