Recombinant Pig Beta-nerve growth factor (NGF), Unconjugated, E. coli

Catalog Number: BIM-RPC23077
Article Name: Recombinant Pig Beta-nerve growth factor (NGF), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23077
Supplier Catalog Number: RPC23077
Alternative Catalog Number: BIM-RPC23077-20UG,BIM-RPC23077-100UG,BIM-RPC23077-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Porcine
Conjugation: Unconjugated
Alternative Names: Beta-NGF
Recombinant Pig Beta-nerve growth factor (NGF) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: NGF. Target Synonyms: Beta-NGF. Accession Number: Q29074. Expression Region: 110~229aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 29.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAGRRA
Target: NGF