Recombinant Phleum pratense Pollen allergen Phl p 5a, Unconjugated, E. coli

Catalog Number: BIM-RPC23095
Article Name: Recombinant Phleum pratense Pollen allergen Phl p 5a, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23095
Supplier Catalog Number: RPC23095
Alternative Catalog Number: BIM-RPC23095-20UG,BIM-RPC23095-100UG,BIM-RPC23095-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Pollen allergen Phl p 5a, Allergen Phl p Va, allergen Phl p 5a, Fragment
Recombinant Phleum pratense Pollen allergen Phl p 5a is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Phleum pratense (Common timothy). Target Name: Phleum pratense Pollen allergen Phl p 5a. Target Synonyms: Pollen allergen Phl p 5a, Allergen Phl p Va, allergen Phl p 5a, Fragment. Accession Number: Q40962. Expression Region: 1~286aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKA
Target: Phleum pratense Pollen allergen Phl p 5a