Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC23108
• Supplier Catalog Number: RPC23108
• Alternative Catalog Number: BIM-RPC23108-20UG,BIM-RPC23108-100UG,BIM-RPC23108-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: dinB, CPS_1040DNA polymerase IV, Pol IV, EC 2.7.7.7

Product Description

Recombinant Colwellia psychrerythraea DNA polymerase IV (dinB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus). Target Name: dinB. Target Synonyms: dinB, CPS_1040DNA polymerase IV, Pol IV, EC 2.7.7.7. Accession Number: Q487H6. Expression Region: 1~352aa. Tag Info: Tag-Free. Theoretical MW: 39.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 39.3kDa
• Tag: Tag-Free
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQARQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIEPLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFLAKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYVTCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETTLAHDI
• Target: dinB