Recombinant Apis mellifera carnica Icarapin, Unconjugated, E. coli

Catalog Number: BIM-RPC23119
Article Name: Recombinant Apis mellifera carnica Icarapin, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23119
Supplier Catalog Number: RPC23119
Alternative Catalog Number: BIM-RPC23119-20UG,BIM-RPC23119-100UG,BIM-RPC23119-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bee
Conjugation: Unconjugated
Alternative Names: Venom protein 2Allergen: Api m 10
Recombinant Apis mellifera carnica Icarapin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apis mellifera carnica (Carniolan honeybee). Target Name: Apis mellifera carnica Icarapin. Target Synonyms: Venom protein 2Allergen: Api m 10. Accession Number: Q5EF78. Expression Region: 20~223aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: FPGAHDEDSKEERKNVDTVLVLPSIERDQMMAATFDFPSLSFEDSDEGSNWNWNTLLRPNFLDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNKIPEGANTTSTTKIIDGHVVTINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSEADSDVTTLPTLIGKNETSTQSSRSVESVEDFDNEIPKNQGDVLTA
Target: Apis mellifera carnica Icarapin