Recombinant Rat CMRF35-like molecule 1 (Cd300lf), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23131
Article Name: Recombinant Rat CMRF35-like molecule 1 (Cd300lf), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23131
Supplier Catalog Number: RPC23131
Alternative Catalog Number: BIM-RPC23131-20UG,BIM-RPC23131-100UG,BIM-RPC23131-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: CD300 antigen-like family member FCD_antigen: CD300f
Recombinant Rat CMRF35-like molecule 1 (Cd300lf), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Cd300lf. Target Synonyms: CD300 antigen-like family member FCD_antigen: CD300f. Accession Number: Q566E6. Expression Region: 19~181aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 38.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 38.3kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS
Target: Cd300lf