Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 (Trim21), Unconjugated, E. coli

Catalog Number: BIM-RPC23188
Article Name: Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 (Trim21), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23188
Supplier Catalog Number: RPC23188
Alternative Catalog Number: BIM-RPC23188-20UG,BIM-RPC23188-100UG,BIM-RPC23188-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: 52 kDa Ro protein52 kDa ribonucleoprotein autoantigen Ro/SS-ARo(SS-A)Sjoegren syndrome type A antigen, SS-ATripartite motif-containing protein 21
Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 (Trim21) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Trim21. Target Synonyms: 52 kDa Ro protein52 kDa ribonucleoprotein autoantigen Ro/SS-ARo(SS-A)Sjoegren syndrome type A antigen, SS-ATripartite motif-containing protein 21. Accession Number: Q62191. Expression Region: 1~470aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 70.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 70.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIIL
Target: Trim21