Recombinant Human Anamorsin (CIAPIN1), Unconjugated, E. coli

Catalog Number: BIM-RPC23194
Article Name: Recombinant Human Anamorsin (CIAPIN1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23194
Supplier Catalog Number: RPC23194
Alternative Catalog Number: BIM-RPC23194-20UG,BIM-RPC23194-100UG,BIM-RPC23194-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cytokine-induced apoptosis inhibitor 1
Recombinant Human Anamorsin (CIAPIN1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CIAPIN1. Target Synonyms: Cytokine-induced apoptosis inhibitor 1. Accession Number: Q6FI81. Expression Region: 1~312aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAE
Target: CIAPIN1