Recombinant Plasmodium falciparum Plasmepsin I (PMI), Unconjugated, E. coli

Catalog Number: BIM-RPC23202
Article Name: Recombinant Plasmodium falciparum Plasmepsin I (PMI), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23202
Supplier Catalog Number: RPC23202
Alternative Catalog Number: BIM-RPC23202-20UG,BIM-RPC23202-100UG,BIM-RPC23202-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Aspartic hemoglobinase IPfAPG
Recombinant Plasmodium falciparum Plasmepsin I (PMI) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Plasmodium falciparum (isolate 3D7). Target Name: PF14_0076. Target Synonyms: Aspartic hemoglobinase IPfAPG. Accession Number: Q7KQM4. Expression Region: 125~452aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 52.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 52.9kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AGDSVTLNDVANVMYYGEAQIGDNKQKFAFIFDTGSANLWVPSAQCNTIGCKTKNLYDSNKSKTYEKDGTKVEMNYVSGTVSGFFSKDIVTIANLSFPYKFIEVTDTNGFEPAYTLGQFDGIVGLGWKDLSIGSVDPVVVELKNQNKIEQAVFTFYLPFDDKHKGYLTIGGIEDRFYEGQLTYEKLNHDLYWQVDLDLHFGNLTVEKATAIVDSGTSSITAPTEFLNKFFEGLDVVKIPFLPLYITTCNNPKLPT
Target: PF14_0076