Recombinant Human Tubulinyl-Tyr carboxypeptidase 1 (VASH1), Unconjugated, E. coli

Catalog Number: BIM-RPC23203
Article Name: Recombinant Human Tubulinyl-Tyr carboxypeptidase 1 (VASH1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23203
Supplier Catalog Number: RPC23203
Alternative Catalog Number: BIM-RPC23203-20UG,BIM-RPC23203-100UG,BIM-RPC23203-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: KIAA1036 (VASH)
Recombinant Human Tubulinyl-Tyr carboxypeptidase 1 (VASH1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: VASH1. Target Synonyms: KIAA1036 (VASH). Accession Number: Q7L8A9. Expression Region: 1~204aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Target: VASH1