Recombinant E. coli Probable phosphatidylethanolamine transferase Mcr-1 (mcr1), partial, Unconjugated

Product Overview

• Article Name: Recombinant E. coli Probable phosphatidylethanolamine transferase Mcr-1 (mcr1), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC23207
• Supplier Catalog Number: RPC23207
• Alternative Catalog Number: BIM-RPC23207-20UG,BIM-RPC23207-100UG,BIM-RPC23207-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: E. coli
• Conjugation: Unconjugated
• Alternative Names: Polymyxin resistance protein MCR-1

Product Description

Recombinant E. coli Probable phosphatidylethanolamine transferase Mcr-1 (mcr1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli. Target Name: mcr1. Target Synonyms: Polymyxin resistance protein MCR-1. Accession Number: A0A0R6L508. Expression Region: 178~541aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 56.7kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: HYASFFRVHKPLRSYVNPIMPIYSVGKLASIEYKKASAPKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSFNGYERDTFPQLAKIDGVTNFSNVTSCGTSTAYSVPCMFSYLGADEYDVDTAKYQENVLDTLDRLGVSILWRDNNSDSKGVMDKLPKAQFADYKSATNNAICNTNPYNECRDVGMLVGLDDFVAANNGKDMLIMLHQMGNHGPAYFKRYDEKFAKFTPVCEGNELAKCEHQSLINAYD
• Target: mcr1