Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23208
Article Name: Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23208
Supplier Catalog Number: RPC23208
Alternative Catalog Number: BIM-RPC23208-20UG,BIM-RPC23208-100UG,BIM-RPC23208-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: TFIIF-associating CTD phosphatase
Recombinant Mouse RNA polymerase II subunit A C-terminal domain phosphatase (Ctdp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ctdp1. Target Synonyms: TFIIF-associating CTD phosphatase. Accession Number: Q7TSG2. Expression Region: 178~341aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR
Target: Ctdp1