Recombinant Pseudomonas azotoformans L-amino acid amidase (laaA), Unconjugated, E. coli

Catalog Number: BIM-RPC23212
Article Name: Recombinant Pseudomonas azotoformans L-amino acid amidase (laaA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23212
Supplier Catalog Number: RPC23212
Alternative Catalog Number: BIM-RPC23212-20UG,BIM-RPC23212-100UG,BIM-RPC23212-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: laaAL-amino acid amidase, EC 3.5.1.101
Recombinant Pseudomonas azotoformans L-amino acid amidase (laaA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pseudomonas azotoformans. Target Name: laaA. Target Synonyms: laaAL-amino acid amidase, EC 3.5.1.101. Accession Number: Q76KX0. Expression Region: 1~310aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 54.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 54.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MEFIEKIREGYAAFGAYQTWYRVTGDLSSGRTPLVVIHGGPGCTHDYVDAFKDVAASGHAVIHYDQLGNGRSTHLPDKDPSFWTVGLFLEELNNLLDHLQISDNYAILGQSWGGMLGSEHAILQPKGLRAFIPANSPTCMRTWVSEANRLRKLLPEGVHETLLKHETAGTYQDPEYLAASRVFYDHHVCRVIPWPEEVARTFAAVDADPTVYHAMSGPTEFHVIGSLKDWKSTGRLSAINVPTLVISGRHDEATP
Target: laaA