Recombinant Arachis hypogaea Conglutin-7, Unconjugated, E. coli

Catalog Number: BIM-RPC23236
Article Name: Recombinant Arachis hypogaea Conglutin-7, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23236
Supplier Catalog Number: RPC23236
Alternative Catalog Number: BIM-RPC23236-20UG,BIM-RPC23236-100UG,BIM-RPC23236-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Conglutin-7, 2S protein 1, Seed storage protein SSP1, Seed storage protein SSP2, allergen Ara h 2
Recombinant Arachis hypogaea Conglutin-7 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Arachis hypogaea (Peanut). Target Name: Arachis hypogaea Conglutin-7. Target Synonyms: Conglutin-7, 2S protein 1, Seed storage protein SSP1, Seed storage protein SSP2, allergen Ara h 2. Accession Number: Q6PSU2. Expression Region: 22~172aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 22kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY
Target: Arachis hypogaea Conglutin-7