Recombinant Human ALK and LTK ligand 1 (ALKAL1), Unconjugated, E. coli

Catalog Number: BIM-RPC23238
Article Name: Recombinant Human ALK and LTK ligand 1 (ALKAL1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23238
Supplier Catalog Number: RPC23238
Alternative Catalog Number: BIM-RPC23238-20UG,BIM-RPC23238-100UG,BIM-RPC23238-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ALKAL1, FAM150A, UNQ9433/PRO34745ALK and LTK ligand 1, Augmentor beta, AUG-beta, Protein FAM150A
Recombinant Human ALK and LTK ligand 1 (ALKAL1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ALKAL1. Target Synonyms: ALKAL1, FAM150A, UNQ9433/PRO34745ALK and LTK ligand 1, Augmentor beta, AUG-beta, Protein FAM150A. Accession Number: Q6UXT8. Expression Region: 28~129aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 25.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.5kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
Target: ALKAL1