Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA), Unconjugated, E. coli

Catalog Number: BIM-RPC23246
Article Name: Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23246
Supplier Catalog Number: RPC23246
Alternative Catalog Number: BIM-RPC23246-20UG,BIM-RPC23246-100UG,BIM-RPC23246-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Fur-regulated protein AStaphylococcal transferrin-binding protein AfrpA, stbA
Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MSSA476). Target Name: isdA. Target Synonyms: Fur-regulated protein AStaphylococcal transferrin-binding protein AfrpA, stbA. Accession Number: Q6GA85. Expression Region: 47~316aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: ATEATNATNNQSTQVSQATSQPINFQVQKDGSSEKSHMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLADAAKPNNVKPVQPKPAQPKTPTEQTKPVQPKVEKVKPTVTTTSKVEDNHSTKVVSTDTTKDQTKTQTAHTVKTAQTAQEQNKVQTPVKDVATAKSESNNQAVSDNKSQQTNKVTKHN
Target: isdA