Recombinant Vesicular stomatitis Indiana virus Protein C (P), Unconjugated, E. coli

Catalog Number: BIM-RPC23252
Article Name: Recombinant Vesicular stomatitis Indiana virus Protein C (P), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23252
Supplier Catalog Number: RPC23252
Alternative Catalog Number: BIM-RPC23252-20UG,BIM-RPC23252-100UG,BIM-RPC23252-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: PProtein C
Recombinant Vesicular stomatitis Indiana virus Protein C (P) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV). Target Name: p. Target Synonyms: PProtein C. Accession Number: Q86132. Expression Region: 1~67aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 11.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL
Target: p