Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23253
Article Name: Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23253
Supplier Catalog Number: RPC23253
Alternative Catalog Number: BIM-RPC23253-20UG,BIM-RPC23253-100UG,BIM-RPC23253-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ITIH5, KIAA1953, PP14776, UNQ311/PRO354, Inter-alpha-trypsin inhibitor heavy chain H5, ITI heavy chain H5, ITI-HC5, Inter-alpha-inhibitor heavy chain 5
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ITIH5. Target Synonyms: ITIH5, KIAA1953, PP14776, UNQ311/PRO354, Inter-alpha-trypsin inhibitor heavy chain H5, ITI heavy chain H5, ITI-HC5, Inter-alpha-inhibitor heavy chain 5. Accession Number: Q86UX2. Expression Region: 35~161aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 30.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE
Target: ITIH5