Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1), Unconjugated, E. coli

Catalog Number: BIM-RPC23261
Article Name: Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23261
Supplier Catalog Number: RPC23261
Alternative Catalog Number: BIM-RPC23261-20UG,BIM-RPC23261-100UG,BIM-RPC23261-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Nmes1Normal mucosa of esophagus-specific gene 1 protein
Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Nmes1. Target Synonyms: Nmes1Normal mucosa of esophagus-specific gene 1 protein. Accession Number: Q810Q5. Expression Region: 1~83aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 25.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
Target: Nmes1