Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3), Unconjugated, E. coli

Catalog Number: BIM-RPC23637
Article Name: Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23637
Supplier Catalog Number: RPC23637
Alternative Catalog Number: BIM-RPC23637-20UG,BIM-RPC23637-100UG,BIM-RPC23637-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Collagenous repeat-containing sequence 26 kDa proteinCORS26Secretory protein CORS26Ctrp3
Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: C1qtnf3. Target Synonyms: Collagenous repeat-containing sequence 26 kDa proteinCORS26Secretory protein CORS26Ctrp3. Accession Number: Q9ES30. Expression Region: 23~246aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 31.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 31.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Target: C1qtnf3