Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC23669
Article Name: Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23669
Supplier Catalog Number: RPC23669
Alternative Catalog Number: BIM-RPC23669-20UG,BIM-RPC23669-100UG,BIM-RPC23669-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: CD_antigen: CD242
Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Icam4. Target Synonyms: CD_antigen: CD242. Accession Number: Q9ERM2. Expression Region: 23~231aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 39.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 39.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS
Target: Icam4