Recombinant Human SUMO-activating enzyme subunit 1 (SAE1), Unconjugated, E. coli

Catalog Number: BIM-RPC23683
Article Name: Recombinant Human SUMO-activating enzyme subunit 1 (SAE1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC23683
Supplier Catalog Number: RPC23683
Alternative Catalog Number: BIM-RPC23683-20UG,BIM-RPC23683-100UG,BIM-RPC23683-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Ubiquitin-like 1-activating enzyme E1A
Accession Number: Q9UBE0. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1~346aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cell Biology. Shipping Condition: Ice packs. Short Description: Recombinant Human SUMO-activating enzyme subunit 1 (SAE1) is a purified Recombinant Protein
Molecular Weight: 65.4kDa
Tag: N-Terminal Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKG
Target: SAE1