Recombinant Human ATP-dependent RNA helicase DDX19A (DDX19A), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human ATP-dependent RNA helicase DDX19A (DDX19A), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC23727
• Supplier Catalog Number: RPC23727
• Alternative Catalog Number: BIM-RPC23727-20UG,BIM-RPC23727-100UG,BIM-RPC23727-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: DDX19-like proteinDEAD box protein 19A

Product Description

Accession Number: Q9NUU7. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 1~478aa. Protein Length: Full Length. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Transport. Shipping Condition: Ice packs. Short Description: Recombinant Human ATP-dependent RNA helicase DDX19A (DDX19A) is a purified Recombinant Protein

Product Properties

• Molecular Weight: 70kDa
• Tag: N-Terminal 6Xhis-Sumo-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQD
• Target: DDX19A