Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC25451
Article Name: Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25451
Supplier Catalog Number: RPC25451
Alternative Catalog Number: BIM-RPC25451-20UG,BIM-RPC25451-100UG,BIM-RPC25451-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Dock8Dedicator of cytokinesis protein 8
Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Dock8. Target Synonyms: Dock8Dedicator of cytokinesis protein 8. Accession Number: Q8C147. Expression Region: 561~730aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 21.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV
Target: Dock8