Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC25507
Article Name: Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25507
Supplier Catalog Number: RPC25507
Alternative Catalog Number: BIM-RPC25507-20UG,BIM-RPC25507-100UG,BIM-RPC25507-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: I12R2_HUMAN, IL-12 receptor subunit beta-2, IL-12R subunit beta-2, IL-12R-beta-2, IL-12RB2, IL12 receptor beta 2, IL12R beta2, IL12RB2, Interleukin 12 receptor beta 2, Interleukin 12 receptor beta 2 chain, Interleukin-12 receptor subunit beta-2, RP11 102
Accession Number: Q99665. Activity: Not Tested. Endotoxin Level: Not Tested. Expiration: 12 months. Expression Region: 24~622aa. Protein Length: Extracellular Domain. Protein Type: Recombinant Protein. Quality Guarantee: This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details. Quality Systems: This product is manufactured at ISO 9001 certified facilities. Reconstitution: Refer to the datasheet/CoA included in the product pouch. Research Area: Cancer. Shipping Condition: Ice packs. Short Description: Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial is a purified Recombinant Protein
Molecular Weight: 69.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKG
Target: IL12RB2