Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25589
Article Name: Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25589
Supplier Catalog Number: RPC25589
Alternative Catalog Number: BIM-RPC25589-20UG,BIM-RPC25589-100UG,BIM-RPC25589-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor, MCAFMonocyte chemotactic protein 1, MCP-1Monocyte secretory protein JESmall-inducible cytokine A2
Recombinant Mouse C-C motif chemokine 2 (Ccl2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: CCL2. Target Synonyms: HC11Monocyte chemoattractant protein 1Monocyte chemotactic and activating factor, MCAFMonocyte chemotactic protein 1, MCP-1Monocyte secretory protein JESmall-inducible cytokine A2. Accession Number: P10148. Expression Region: 24~96aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 12.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR
Target: CCL2