Recombinant Human CCN family member 2 (CCN2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25590
Article Name: Recombinant Human CCN family member 2 (CCN2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25590
Supplier Catalog Number: RPC25590
Alternative Catalog Number: BIM-RPC25590-20UG,BIM-RPC25590-100UG,BIM-RPC25590-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8, IBP-8, IGF-binding protein 8, IGFBP-8
Recombinant Human CCN family member 2 (CCN2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CCN2. Target Synonyms: CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8, IBP-8, IGF-binding protein 8, IGFBP-8. Accession Number: P29279. Expression Region: 253~349aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 15.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 15.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Target: CCN2