Recombinant Human Glutathione S-transferase P (GSTP1), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Human Glutathione S-transferase P (GSTP1), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC25592
• Supplier Catalog Number: RPC25592
• Alternative Catalog Number: BIM-RPC25592-20UG,BIM-RPC25592-100UG,BIM-RPC25592-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: GST class-piGSTP1-1

Product Description

Recombinant Human Glutathione S-transferase P (GSTP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GSTP1. Target Synonyms: GST class-piGSTP1-1. Accession Number: P09211. Expression Region: 2~210aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 27.2kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
• Target: GSTP1