Recombinant Human Plasminogen (PLG), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25710
Article Name: Recombinant Human Plasminogen (PLG), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25710
Supplier Catalog Number: RPC25710
Alternative Catalog Number: BIM-RPC25710-20UG,BIM-RPC25710-100UG,BIM-RPC25710-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Plasmin, Plasmin heavy chain A, Plasmin light chain B, Plasminogen, PLG, PLMN_HUMAN
Recombinant Human Plasminogen (PLG), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PLG. Target Synonyms: Plasmin, Plasmin heavy chain A, Plasmin light chain B, Plasminogen, PLG, PLMN_HUMAN. Accession Number: P00747. Expression Region: 274~560aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEK
Target: PLG