Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial, Unconjugated, Virus

Catalog Number: BIM-RPC27236
Article Name: Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC27236
Supplier Catalog Number: RPC27236
Alternative Catalog Number: BIM-RPC27236-20UG,BIM-RPC27236-100UG,BIM-RPC27236-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 180 kDa secretory phospholipase A2 receptorC-type lectin domain family 13 member CM-type receptor
Recombinant Human Secretory phospholipase A2 receptor (PLA2R1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PLA2R1. Target Synonyms: 180 kDa secretory phospholipase A2 receptorC-type lectin domain family 13 member CM-type receptor. Accession Number: Q13018. Expression Region: 395~530aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
Target: PLA2R1