Recombinant African swine fever virus Virus attachment protein p12 (Pret-110), Unconjugated

Catalog Number: BIM-RPC27242
Article Name: Recombinant African swine fever virus Virus attachment protein p12 (Pret-110), Unconjugated
Biozol Catalog Number: BIM-RPC27242
Supplier Catalog Number: RPC27242
Alternative Catalog Number: BIM-RPC27242-20UG,BIM-RPC27242-100UG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Protein p12
Recombinant African swine fever virus Virus attachment protein p12 (Pret-110) is a purified CF Transmembrane Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV). Target Name: Pret-110. Target Synonyms: Protein p12. Accession Number: P0C9Y3. Expression Region: 1~61aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 12.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 12.7kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS
Target: Pret-110