Recombinant Vaccinia virus Protein B5 (PS/HR), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC28338
Article Name: Recombinant Vaccinia virus Protein B5 (PS/HR), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC28338
Supplier Catalog Number: RPC28338
Alternative Catalog Number: BIM-RPC28338-20UG,BIM-RPC28338-100UG,BIM-RPC28338-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Plaque-size/host range protein
Recombinant Vaccinia virus Protein B5 (PS/HR), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain Copenhagen) (VACV). Target Name: PS/HR. Target Synonyms: Plaque-size/host range protein. Accession Number: P21115. Expression Region: 18~279aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 31.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 31.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIE
Target: PS/HR