Recombinant Brugia malayi tRNA (guanine-N (7)-)-methyltransferase (Bm1_01445), Unconjugated, E. coli

Catalog Number: BIM-RPC28343
Article Name: Recombinant Brugia malayi tRNA (guanine-N (7)-)-methyltransferase (Bm1_01445), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC28343
Supplier Catalog Number: RPC28343
Alternative Catalog Number: BIM-RPC28343-20UG,BIM-RPC28343-100UG,BIM-RPC28343-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Parasite
Conjugation: Unconjugated
Alternative Names: tRNA (guanine(46)-N(7))-methyltransferasetRNA(m7G46)-methyltransferase
Recombinant Brugia malayi tRNA (guanine-N (7)-)-methyltransferase (Bm1_01445) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Brugia malayi (Filarial nematode worm). Target Name: Bm1_01445. Target Synonyms: tRNA (guanine(46)-N(7))-methyltransferasetRNA(m7G46)-methyltransferase. Accession Number: A8NFF0. Expression Region: 1~258aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 36.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.3kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MVSTENKIGLFKNKDDDIDGEEMRELPQKKFYRQRAHANPISDHEFDYPVFPEQMDWKKYFGDFSEGRQVEFADVGCGYGGLLIKLSTLYPEALMVGLEIRVKVSDYVQDKIHALRLREPGNYRNVACLRTNAMKYLPNYFRRHQLTKMFFLYPDPHFKKAKHKWRIITPTLLAEYAYVLKPGGLVYTITDVEELHIWMVRHLSAHPLFERLTDLEMKMDPVVEMLYDSTEEGQKVARNEGSKWSAVFRRLPNPV
Target: Bm1_01445